User Tools

Site Tools


blastocystis_orf160

Differences

This shows you the differences between two versions of the page.

Link to this comparison view

Both sides previous revisionPrevious revision
Next revision
Previous revision
blastocystis_orf160 [2025/07/10 10:47] – [The search for alternative initiatior tRNAs] 134.190.145.228blastocystis_orf160 [2025/11/10 15:20] (current) – [Little to no expression of orf160 in regular and riboZeroPlus RNAseq data of ST7C] 134.190.191.148
Line 1: Line 1:
 ===== orf160 in Blastocystis mitochondrial genomes ===== ===== orf160 in Blastocystis mitochondrial genomes =====
  
-==== The Literature: Jacob et al, 2016, GBE ====+Knowledge from the Literature: Jacob et al, 2016, GBE
  
 === Basic properties === === Basic properties ===
Line 25: Line 25:
 === orf160 (negative strand) overlaps with its upstream neighbor, nad7 (negative strand) === === orf160 (negative strand) overlaps with its upstream neighbor, nad7 (negative strand) ===
  
-Jacob //et al// identified a 55 or 56 bp overlap on the N-terminal end of //orf160//. This means that the first 19 codons / aa’s of //orf160// overlap with the C-terminus of //nad7//. We checked with the //Blastocystis// NandII strain the overlap with //nad7//+Jacob //et al// identified a 55 or 56 bp overlap on the 5 prime end of //orf160//. This means that the first 19 codons / aa’s of //orf160// overlap with the 3 prime end of //nad7//. We checked with the //Blastocystis// NandII strain the overlap with //nad7//
  
 === No evidence as of yet for transcription of this gene === === No evidence as of yet for transcription of this gene ===
Line 35: Line 35:
 If this is true, all mitochondrial genes should end with ''%%TAA%%'' or ''%%TGA%%'', which according to Jacob //et al// is not always true. If this is true, we should be able to find a tRNA with an anticodon able to recognize ''%%TAG%%''. Jacob //et al// was unable to find any in the ST1 nuclear genome If this is true, all mitochondrial genes should end with ''%%TAA%%'' or ''%%TGA%%'', which according to Jacob //et al// is not always true. If this is true, we should be able to find a tRNA with an anticodon able to recognize ''%%TAG%%''. Jacob //et al// was unable to find any in the ST1 nuclear genome
  
-=== Hypothesis 2: TAG in position 9 is RNA edited to TAA ===+=== Hypothesis 2: TAG in position 9 is RNA edited to a sense codon ===
  
 Unable to check this hypothesis because no RNA data available Unable to check this hypothesis because no RNA data available
Line 190: Line 190:
 ==== FoldMason alignment of orf160 suggests ATG is not used as a START codon ==== ==== FoldMason alignment of orf160 suggests ATG is not used as a START codon ====
  
-//orf160// sequences within //Blastocystis// are too divergent too get sensible alignments with ''mafft''. Since Foldseek gave us confident hits that it encodes RPL10, we can infer that the structure is fairly well conserved, even if the primary sequence is not. Hence, ideally, we would like to use structural information to align all //orf160// homologs. We can do this with **FoldMason**, another tool from the same guys that developed Foldseek.+//orf160// sequences within //Blastocystis// are too divergent to get sensible alignments with ''mafft''. Since Foldseek gave us confident hits that it encodes RPL10, we can infer that the structure is fairly well conserved, even if the primary sequence is not. Hence, ideally, we would like to use structural information to align all //orf160// homologs. We can do this with **FoldMason**, another tool from the same guys that developed Foldseek.
  
 I ran AlphaFold3 on all Jacob //et al// //orf160// predicted amino acid sequences (replacing ‘*’ with ‘X’) of many different subtypes, and used FoldMason MSA to align these predicted structures with predicted structures of the best Foldseek hits (using ST4 homolog as query). I ran AlphaFold3 on all Jacob //et al// //orf160// predicted amino acid sequences (replacing ‘*’ with ‘X’) of many different subtypes, and used FoldMason MSA to align these predicted structures with predicted structures of the best Foldseek hits (using ST4 homolog as query).
Line 215: Line 215:
 tRNAscan-SE is very specific, but can lack sensitivity in mitochondrial genomes, as its hidden markov models are either from Bacteria, Archaea, Eukaryotic Nuclear, or metazoan/mammalian mitochondrial genomes. **Aragorn** on the other hand is highly sensitive, but not very specific. Seems to be also better at detecting mitochondrial type tRNAs tRNAscan-SE is very specific, but can lack sensitivity in mitochondrial genomes, as its hidden markov models are either from Bacteria, Archaea, Eukaryotic Nuclear, or metazoan/mammalian mitochondrial genomes. **Aragorn** on the other hand is highly sensitive, but not very specific. Seems to be also better at detecting mitochondrial type tRNAs
  
-I applied aragorn in mitochondrial mode to all Jacob //et al// blasto MRO genomes and compared with pre-existing annotations. It found loads of false positives, but there were a few interesting hits:+I applied aragorn in mitochondrial mode to all Jacob //et al// blasto MRO genomes: 
  
 <code> <code>
Line 222: Line 222:
 </code> </code>
  
-<code> +I compared with pre-existing annotations. It found loads of false positives, but there were a few interesting hits: 
-- A tRNA gene in all 3 ST3 strains between _nad6_ and _12S rRNA gene_, with anticodon `aat` (codon `ATT`): + 
-</code>+1. A tRNA gene in all 3 ST3 strains between //nad6// and //12S rRNA gene//, with anticodon `aat` (codon `ATT`): 
  
 <code> <code>
Line 258: Line 259:
 </code> </code>
  
-  * a tRNA in ST6, with ''%%aat%%'' as anticodon, in between Asn and Leu tRNAs in a tRNA block:+2. A tRNA in ST6, with ''%%aat%%'' as anticodon, in between Asn and Leu tRNAs in a tRNA block:
  
 <code> <code>
Line 293: Line 294:
 </code> </code>
  
-  * So both possibly new tRNAs are with the anticodon ''%%aat%%'', which recognizes codon ''%%TTA%%''. The original annotation already had ''%%gat%%'' anticodon Ile, and ''%%ATC%%'' as codon. So perhaps some redundancy here, and so perhaps these new hits are pseudogenes? ''%%aat%%'' could according to theory, only possibly base pair with codon ''%%TTA%%'' +So both possibly new tRNAs are with the anticodon ''%%aat%%'', which recognizes codon ''%%TTA%%''. The original annotation already had ''%%gat%%'' anticodon Ile, and ''%%ATC%%'' as codon. So perhaps some redundancy here, and so perhaps these new hits are pseudogenes? ''%%aat%%'' could according to theory, only possibly base pair with codon ''%%TTA%%''
-  * The Jacob //et al// blasto MRO genomes seem to encode tRNAs for only 14 amino acids, and are lacking tRNAs for Ser, Val, Thr, Gln, Arg and Gly. The mtDNA encoded proteins do include these amino acids, so their tRNAs must be encoded on the nuclear genome, and imported into the mitochondrion. Maybe the alternative initiator tRNA is also imported?+
  
-**Comparing codon alignments of RPS4 and RPL10** - It seems that both RPS4 and RPL10 (//orf160//) possibly lack a typical start codon. If there is an alternative, they could both use the same one, and the codon would be conserved over these two genes across lineages. - I already had the RPL10 FoldMason alignment (see above). I collected RPS4 homologs from Jacob //et al// MRO genomes and //Proteromonas lacertae//, and did a AF3 + FoldMason alignment, and then back transformed it into a codon alignment. - RPS4 of //Blasto// is about 2x the size of that of //Proteromonas//! - The //Proteromonas// copy starts with ''%%ATG%%'' and aligns with the N-terminus of the //Blastocystis// copies. - Also here there is no codon site that is exclusively ''%%ATG%%'' among all lineages, suggesting this gene is using an alternative start - Codons that are close to perfect conservation, in the beginning area of RPL10 and RPS4: ''%%AAA%%'', ''%%AAT%%'',+=== Blastocystis imports many tRNAs from the cytosol ===
  
 +The Jacob //et al// blasto MRO genomes seem to encode tRNAs for only 14 amino acids, and are lacking tRNAs for Ser, Val, Thr, Gln, Arg and Gly. Brocal & Clark, 2008 had already observed this paucity of tRNA genes and called this the "the most dramatic case of tRNA gene loss observed within the stramenopiles". The mtDNA encoded proteins do include these amino acids, so their tRNAs must be encoded on the nuclear genome, and imported into the mitochondrion. Maybe the alternative initiator tRNA is also imported?
 +
 +=== The mitochondrial gene for RPS4 also lacks a START codon in several STs ===
 +
 +RPS4 also lacks a typical start codon in ST1, ST2, ST4 and ST8 (Jacob et al 2016). If they use an alternative START, it may be the same START that //orf160// is using. RPS4 in Blastocystis seems curiously also twice the size of that in //Proteromonas lacertae//.
 +
 +I collected RPS4 homologs from Jacob //et al// MRO genomes and //Proteromonas lacertae//, and did a AF3 + FoldMason alignment, and then back transformed it into a codon alignment. 
 +
 +The AF3 predicted structures, even between closely related Blasto subtypes, do not seem to align very well in 3D.
 +
 +RPS4 of //Blasto// is indeed about 2x the size of that of //Proteromonas// The //Proteromonas// copy starts with ''%%ATG%%''. FoldMason aligned the //Proteromonas// copy with the N-terminus of the //Blastocystis// copies. However, it seemingly only aligns well (in the sequence alignment) with the Blasto copies in a particular section: the section that yields good Foldseek hits with public RPS4 homologs in the databases.
 +
 +I compared the RPS4 codon alignment with that of the RPL10 / orf160 alignment. Codons that seem to be conserved (but not perfectly), in the beginning area of both RPL10 and RPS4 are ''%%AAA%%'', ''%%AAT%%''.
 +
 +However, since the sequences don't even align that well, I'm not even sure where the true RPS4 gene starts and end in Blastocystis and Proteromonas mtDNA.
 +
 +==== Little to no expression of orf160 in regular and riboZeroPlus RNAseq data of ST7C ====
 +
 +To see whether the mysterious //orf160// is actually expressed, I inspected the regular RNAseq, that is, mRNA sequencing via oligo-dT primers/probes, by mapping it on the ST7C genome, that included the MRO genome.
 +
 +Here is the visual overview:
 +
 +{{:overall_mro_expression_on_regularrnaseq.png|}}
 +
 +You can see some RNAseq reads overlapping with ORF160 on its 5' end, and in the proper direction too. However, these may be reads coming from the immediately upstream gene //nad7// (in the IGV figure wrongly annotated as //ndhH//)
 +
 +Since a regular, polyA capturing RNAseq does by its nature not capture mitochondrial transcripts, which are not believed to be poly-adenylated, this lack in expression may come from a pure lack of captured mitochondrial transcripts in the experimental design.
 +
 +I therefore tried to resequence the same RNA sample using a different kit, the riboZeroPlus kit. This kit uses a set of custom designed probes to remove rRNA transcripts from the total RNA extract prior to library prep and sequencing.
 +
 +I used the following probes:
 +
 +<code>
 +- 18S rRNA probes (one per line):
 +
 +TTTCATAAACAAACCAAAAAATCGACTATGAAAGCCAATCTTATTATTCC
 +CAAACACTTTCAATAAATTATCTAAACTTCAACTACGAGCTTTTTAACTG
 +TTATCCATATAGAAACTATTCCAAATAAACTATAACTGATATAATGAGCC
 +CTAACAAGCATGCGATAAAGTCAACAATTATTATTACTCACAATTCAATT
 +TAGCTTTCGTTCTTGATTAATGAAAACATCCTTGGTAAATGCTTTCGCAC
 +CAGATACTCGTTGAATAGTTCAGTGTCGCGCGCGTGCAGCCCAGAACATC
 +CTAAAACTATTTAGACTTACACATGCATGGCTTAATCTTTGAGACGAGCG
 +CCATGGTAGTCCAATACACTACCATCGAAAGCTGATAGGGCAGAAACTTG
 +GAAAAATTACAAGCATCAATCCCCATCACGAACTATTTTCAAAAGATTTC
 +AAATCATAGAATTTCACCTCTAGCTATTGAATATGAATACCCCCAACTGT
 +TCACCTTCCTCTAGATGATAAGATTTACACGACTTCTCTTCAACTATCTA
 +ATAAGTACTTCTTTAATGGTTGCCCATCAAAGAAAACACATGTATTAGCC
 +ACTAACTCCTAGTCGGTATCGTTTATAGCTAAGACTACGAGGGTATCTAA
 +CTATCAATCTGTCAATCCTTCCTATGTCTGGACCTGGTAAGTTTCCCCGT
 +TCCTTGCGGAACCATGGCACCCACCTGGATGTCGATAACTTACATAAAAG
 +GATTTATTGTCACTACCTCCCTGTGTCAGGATTGGGTAATTTACGCGCCT
 +ATAATTAAAAATCCAAAGTGTTCACCGGATCATCCAATCGGTAGGTGCGA
 +AAGGGCAGGGACGTAATCAACGCAAGTTGATGACTTGCATTTACTAGGAA
 +CCTGTTATTGCTTCCAGCTTCCCCGTACTCAAACGCACAGTGTCCCTCTA
 +ACAATGGGGCATTACTAAAATCCCATTTCATCCAACTAATAGGCGGAAGT
 +AACTGAACAGTCCGCTTTAAACACTCTAATTTTCTCACAGTAAATGACCA
 +TGTGGTAGCCATCTCTCAGGCTCCCTCTCCGAAATCGAACCCAAATTCTT
 +ACTCCCCCCGGAACCCAAAGACTTTGATTTCTCATAAGGTACTAATAGAC
 +TTGTTTATCGATAACGATTGTACATTGTTCTCAATTCAATTACAAAACCA
 +
 +- 28S rRNA probes (one per line)
 +
 +CTAACAATGTCTCCCACGTGGGTTGCAACTCGAGAGAGAAGCTTACACAT
 +AGCCTTTGATGGAGTTTACCACCAACTTCGAGCTGCAATCCCAAACAACT
 +AAGCCATCACCCCATATTATGGAATAAGTAAAACAACATTAGAGGTAGTG
 +TCCATGCATCATTCAACCACTCCTACGCTTAACCCCTCCACGATTTCAAG
 +ATTCAAAATATTGAATTCCTTTACCAATAACAAAACCTTTTCGCGGATTC
 +GTCGTCTACAAAGGATCTTTGTTCATTGACCATTAAAAATGCTATCAGGG
 +AGTCCAGCTTACCCGGAATGGCCCACTAGCAACTACTATTCAAAATTACA
 +AGGCTGTTCGCTTAAGCGCCATCCATTTTCAGGGCTACTTCATTCGGCAG
 +TTTTCAAAGTGCTTTTCATCTTTCCCTCACGGTACTTGTTCGCTATCGGT
 +AGCACTGGGCAGAATTCACATTGTGTCAATATATCTTTCACACTATCACA
 +TTTATCAGAGATGCAAGACCGGTAGTTGTTGCTAGCTCTCTTTAGACAAA
 +TTTTCTATCCAACTGAGCGAACAATTAGGCGCCGTACCATATCGTTCGGT
 +AGGTTGACAAATTGCAGAAATAGTTAATAGGGCCGTCCACCTCCCCAGGG
 +GTTTCAAGACGGGACGGAGAAGCAGTTATTAGGAAAGAGGAAATTCAGTA
 +AAGCAACTATAATATCTTACCCATTCAAAGTTTGAGAATAGGTCCAGGAT
 +AAATGTGTTCCCAAAGGGAGGGAAATAATATTACTTTTCAAGGACCCATT
 +AAGCCGTATCTACTCAAATAGGCTTCTTTATATAGGTCACATCCTTTGGT
 +CTGCTTCACAAGTACAATACACTATGCAAATACAGGGTTTTCACCTTCTA
 +GCTACTTCCACCAAGATCTGCACTAATGGACATTCCATATAAGTTTACAC
 +CATTATTCTATTAACTAGAGGCTATTCACCTTGGAGACCTGATGCGGTTA
 +GAGAAGAGGTAATAAGGGAAAGGGAATTAATTGATATTTACCAATTTAAC
 +TACATATTTTAGGAGGGCTTCATGATTAGAGGCTTTCATCACTACGACCC
 +CGTTCAAAGATTCAATGACTCACAGACTTCTGCAGTTCGCATTACGTATC
 +TCTCACATTTTACCCAGTCTGCAAGGTATTGGTAGGAAGAGCCGACATCG
 +AGTTCAACACGATTCCTATGGAACCTTTCTCCACTTCAGTCTTCAAAGAT
 +CGAGAACCACTGTATTCATATCACTAACCTAGTCAATTGAACTGTTGTCG
 +TAGTAGACAGACATCCAAGTCAAATCACACTCCAACAAGCATACTCCCAA
 +AGAGAGTCATAGTTACTCCCGCCGTTTACCCGCGCTTGGTTGAATTCCTT
 +CATCAATCATCTCATTCATTTGATAACCAAGAACTGACGATCCTATCATT
 +TCTGTTACCATTCAATTCCATTTCATTGGTTCAGGAATATTAACCTGATT
 +ACCTTCATTACGCATTTTAGTTTAACACTAAACTACTCGCAAATATGATA
 +GTTCTAAAAATTCAAAAGAACTTTTTCAACGGATTTCACCTATCTCTTAG
 +TTTTCCTCTGCTTAGTTAGATGCTTCAATTCAGCAGGTCTTCTTGCTTGA
 +ATCCAATTCTCATAGTATACTGTTACTAAACAATACTTCTACACTCCACA
 +CCTAGCCCTCAGAGCCAATCCTTATCCCGAAGTTACGGATCTAATTTGCC
 +ATTCTATTTCAATGGAGGAAACTCTTAGTCAATCCACCATCAATCATCGT
 +TTCGTCCTATTCAGGCATAGTTCACCATCTTTCGGGTCCCACCATCTTTG
 +CCCTTAAAAAGAGTCTCCCACCTATTCTACACCCTCTAAGTCATTTCACA
 +CATACTGAAAATCAAAATCAAATGAGCTTTTACCCTTTTATTCTACGTAA
 +TGAGCTCATCTTAGGACACCTGTGTTATTCTTTAACAGATGTGCCGCCCC
 +GATAAGTCTCAATTTCTCGTTGAACTAAGTCAACTCGAAAACTTACAACC
 +CCTCTAATCATTCGCTTTACCTCATAAAACTAGACACAGTTGCAGCTATC
 +GTGTTAATTCGGATTGGGCTTTTCCCACTTCACTCGCCGTTACTAAGGGA
 +TCCATCACGCCTTCCTACTTGTCACCCCATAATATAACCATCTACTTGAG
 +CTAGCTTTAAACTCGAAATTCAAATATCTAAAGGATCGATAGGCCATATT
 +TAAACAGTCGGATTCCCCTTGTCCGTACCAGTTCTGAGTCAGCTATTCAT
 +CCCAAATTTAAAGATCAATTTGCACGTTAGAATCCACTCGAACCTCCACC
 +TTTATTATTGTTAACAAGAAAAGAAAACTCTTCCCAGGAGAGTAACCGAT
 +TACCACCACTAAACAACCACTCCTTTGCATACATTCTTATCATCACAAAC
 +CAAGCTCAACAGGGTCTTCTTTCCCCGCTGATATTTCCAAGCCCATTCCC
 +
 +</code>
 +
 +Sequencing was done at the Genomics CORE Lab in the LSRI, with Mat as contact person.
 +
 +The sequencing run was excellent. Got a lot of data, and it was also really good quality.
 +
 +After quality trimming the data, I mapped it to the latest version of the ST7C genome with HISAT2.
 +
 +A lot of reads still mapped to the rRNA genes, but all the other areas still had more than sufficient enough coverage as well.
 +
 +Importantly, **the mitochondrial genome had much more reads mapping to it**:
 +
 +{{:overall_mro_expression_ribozero.png|}}
 +
 +**This is not just the result of a higher throughput**. The throughput of the riboZeroPlus run (179 506 076 mapped reads) was about twice that of the original RNAseq run (85 875 153 reads), but far more than twice time the amount of reads now mapped to the MRO genome. (NOTE that for both IGV figures I used the same coverage scale of 2000 in the Coverage track).
 +
 +What is striking is that the mitochondrial rRNA genes still had an enormous amount of coverage. Perhaps next time you want to sequence the mitochondrial transcriptome of some organism, also include probes targeting the mitochondrial rRNA genes!
 +
 +Another striking thing is that it seems that **RNAseq coverage of mitochondrial ribosomal genes is much lower** than that of the //nad// genes! Exceptions seem to be //rps12// and //rpl16//.
 +
 +Zooming in to //orf160// / //rpl10//:
 +
 +{{:orf160_expression_screenshot.png|}}
 +
 +Unfortunately again it seems we are not seeing any significant evidence of expression of this gene. It may be that the throughput for this gene in particular was not high enough to detect any real expression, so we can't rule it out. Any reads that are overlapping with orf160 may be 3'UTR reads from the //nad7// gene upstream (here annotated as NdhH)
 ====== Ideas to explore ====== ====== Ideas to explore ======
  
   * Check RNA expression levels   * Check RNA expression levels
-  * What makes a start codon a start codon?+  * Try to sequence mitochondrial RNA or specifically orf160 RNA (RT-PCR plus sequencing - Jacob et al designed primers for orf160 and rps4, but were unsuccesful). As of July 2025, we still have (I think) total RNA extracts from ST7C, E and H in the -80 in the main lab (in one of Gregs boxes). 
 +  * 
   * check for shine dalgarno sequences, possibly after the in-frame start codon?   * check for shine dalgarno sequences, possibly after the in-frame start codon?
   * Andrew: I guess to know if this is ‘significant’ you’d have to look at the density of these kinds of codons throughout the whole sequence. Since mtDNAs like this are A+T-rich, codons that are ‘close’ to ‘ATG’ might not be so rare.   * Andrew: I guess to know if this is ‘significant’ you’d have to look at the density of these kinds of codons throughout the whole sequence. Since mtDNAs like this are A+T-rich, codons that are ‘close’ to ‘ATG’ might not be so rare.
Line 327: Line 466:
 QYPTIKIQFFKKSNRNIYLIFLLPYLTNSLILLGCNELNVFFKLCECVSKNILFIKVQNT QYPTIKIQFFKKSNRNIYLIFLLPYLTNSLILLGCNELNVFFKLCECVSKNILFIKVQNT
 IYSINQFMDCSSNQIMFGQTLNSLYYNLIKVFYSFSLLHK* IYSINQFMDCSSNQIMFGQTLNSLYYNLIKVFYSFSLLHK*
 +
 +$$$, &&&, ^^^ and %%% and ### are codons 1 base different from ATG
  
 >KU900236_9694-10176 >KU900236_9694-10176
blastocystis_orf160.1752155272.txt.gz · Last modified: by 134.190.145.228